Protein Info for ABZR87_RS06555 in Ralstonia sp. UNC404CL21Col

Annotation: helix-turn-helix transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 PF01381: HTH_3" amino acids 31 to 75 (45 residues), 27.8 bits, see alignment 6.4e-10 PF08447: PAS_3" amino acids 138 to 215 (78 residues), 42.4 bits, see alignment E=2e-14 amino acids 260 to 342 (83 residues), 46.1 bits, see alignment E=1.5e-15 TIGR00229: PAS domain S-box protein" amino acids 358 to 473 (116 residues), 55.9 bits, see alignment E=2.3e-19 PF13188: PAS_8" amino acids 362 to 411 (50 residues), 28.7 bits, see alignment 2.8e-10 PF00989: PAS" amino acids 363 to 460 (98 residues), 25.9 bits, see alignment E=2.5e-09 PF08448: PAS_4" amino acids 368 to 474 (107 residues), 27.5 bits, see alignment E=9.6e-10 PF13426: PAS_9" amino acids 372 to 460 (89 residues), 23.3 bits, see alignment E=1.9e-08

Best Hits

Predicted SEED Role

"sensory transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (481 amino acids)

>ABZR87_RS06555 helix-turn-helix transcriptional regulator (Ralstonia sp. UNC404CL21Col)
MTAAALPPPDGPIDDDSFAGRLKGVLTRGRIQLKQVAAALRVSPSAVHKWTRGGEIEYAN
LLALARFLNVNWLWLRYGDRALADLEASLTTDVRAREGRQKHIAAIMESEARMTFAQEIS
GVVTWEWNLLTDAVAYSPNAARLFGRPIRTLDDFWQCVLPEDVPGVQAAVSQNLSAGGVY
EHEFRIAPAPDVVRWIVSRATLVRDAQDRPVKMIGLSLDTTERHTAEAALRDSEALLAKA
QQIAHLGSWLWEPGTDACRWTDEAYRIFGWAPQSTPVTMARYLEAIVPADRARVQAVLDR
AVASRQPYRVEYTITLPDGSHRHLREEGEAQDPSAATPTMIGAAQDITAEVEAQAAFRDS
EAKLRTLFEQVPVGIAQVSLEGRCLRANPWLCTLLGQSETALQQRTLLDLTHRNDLARHL
RQYGELLAGTVPTYALSLQLVRGDGSAVPVRITTSLARDPATDAPLHLITVVDTVPEAGA
S