Protein Info for ABZR87_RS06400 in Ralstonia sp. UNC404CL21Col

Annotation: response regulator transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 PF00072: Response_reg" amino acids 4 to 116 (113 residues), 105.8 bits, see alignment E=1.4e-34 PF00196: GerE" amino acids 147 to 203 (57 residues), 59.1 bits, see alignment E=2.7e-20

Best Hits

Swiss-Prot: 37% identical to NREC_STAA1: Oxygen regulatory protein NreC (nreC) from Staphylococcus aureus (strain Mu3 / ATCC 700698)

KEGG orthology group: None (inferred from 99% identity to rsl:RPSI07_3121)

Predicted SEED Role

"DNA-binding response regulator, LuxR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>ABZR87_RS06400 response regulator transcription factor (Ralstonia sp. UNC404CL21Col)
MIRVLIADDHEIVRAGLRQFLSEERDIEVAGEAASGEEVMEQLRTGAFDVVVLDISMPDR
NGIDTLKLARQRHPDLPVLILSTFPEDQYAINLIRAGASGYLTKESAPDELVKAIRTVSQ
GRRYVSPTVAELLIGGLEKPTDQPLHQTLSKREFQIFCKLARGQSVSIIAEELFLSVKTV
STYRTRILEKMGMKSNADLTYYAIKNGLVE