Protein Info for ABZR87_RS05635 in Ralstonia sp. UNC404CL21Col

Annotation: muropeptide transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 48 to 70 (23 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 225 to 251 (27 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details amino acids 317 to 344 (28 residues), see Phobius details amino acids 354 to 372 (19 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 257 (239 residues), 61.3 bits, see alignment E=8.3e-21 amino acids 242 to 406 (165 residues), 40.6 bits, see alignment E=1.6e-14 PF13000: Acatn" amino acids 19 to 96 (78 residues), 32.9 bits, see alignment E=2.9e-12

Best Hits

Swiss-Prot: 67% identical to AMPG_ECO57: Anhydromuropeptide permease (ampG) from Escherichia coli O157:H7

KEGG orthology group: K08218, MFS transporter, PAT family, beta-lactamase induction signal transducer AmpG (inferred from 99% identity to rpi:Rpic_0047)

MetaCyc: 67% identical to muropeptide:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-226; TRANS-RXN0-258

Predicted SEED Role

"AmpG permease"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>ABZR87_RS05635 muropeptide transporter (Ralstonia sp. UNC404CL21Col)
MTFHDYLDIFRNRRIGAMLLLGFASGLPLALTSGTLQAWMTVEGLDIRTIGLFSLVGQAY
IFKFLWAPLMDRFTPPLMGRRRGWLVLTQAGLVASIAAMAFTPPHAALWALAGLAVLVAF
LSASQDIVFDAYSTDVLHSSERGVGAAVKVLGYRLAMLVSGGLALYLADRVMGWSNMYLL
MAGLMALGIFTTLWSPEPEVSARPPRSLQEAVVGPLRDFFSRRGAWALLALIVLYKLGDA
FAGSLSTTFLIRGVGFSAGEVGIVNKTLGLAATIVGALYGGTLMVRLGLVRALLLFGVLQ
AVSNLGYWVLAVTPQHLWTMAVAIGIENICGGMGTAAFVALLMALCNRSFSATQYALLSA
LASIGRVYVGPTSGYLVEAYGWPAFYLMTVVFAFPGLALLWWMRGTIGRYEAEQNERALE
AKAAKAASA