Protein Info for ABZR87_RS05235 in Ralstonia sp. UNC404CL21Col

Annotation: D-erythronate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 1 to 173 (173 residues), 32.8 bits, see alignment E=1e-11 PF01370: Epimerase" amino acids 3 to 209 (207 residues), 81.2 bits, see alignment E=2e-26 PF01073: 3Beta_HSD" amino acids 4 to 203 (200 residues), 47 bits, see alignment E=4.5e-16 PF16363: GDP_Man_Dehyd" amino acids 5 to 170 (166 residues), 59.1 bits, see alignment E=1.3e-19 PF07993: NAD_binding_4" amino acids 5 to 189 (185 residues), 37.7 bits, see alignment E=3.3e-13

Best Hits

Swiss-Prot: 58% identical to DEND_CUPNH: D-erythronate dehydrogenase (denD) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 98% identity to rpf:Rpic12D_3407)

MetaCyc: 45% identical to D-erythronate 2-dehydrogenase (Haemophilus influenzae Rd KW20)
RXN-18591 [EC: 1.1.1.410]

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.410

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>ABZR87_RS05235 D-erythronate dehydrogenase (Ralstonia sp. UNC404CL21Col)
MNIVITGGAGFLGQRVLAALLEQPGLPDADGSVQPVETFIVLDQVAGQIADARVRYVTGD
ASDPALIAKVIDENVGGVFHLAAVVSGTAEADFDLGMRVNLDGTRALLDALRAQHAKTGR
APRVLFASSVAVFGGQLPAVVTDDTAATPQASYGVQKLMGEFLVGEYSRKGYIDGRAVRI
PTVSVRPGKPNGAASSFASGIIREPLSGEEAICPVEAETELWLASPRQVVASLLHAYTLP
ASAWGHRRSLNLPGITVRVGEMVEALRKVAGDAPVSRIRWEPDARIKAIVQSWPARFDTA
RADAMGFGRDTSFEAMVRDYVDSAKGV