Protein Info for ABZR87_RS04855 in Ralstonia sp. UNC404CL21Col

Annotation: adenosylhomocysteinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 PF05221: AdoHcyase" amino acids 10 to 473 (464 residues), 491.6 bits, see alignment E=1.2e-151 TIGR00936: adenosylhomocysteinase" amino acids 11 to 466 (456 residues), 609.1 bits, see alignment E=1.9e-187 PF00670: AdoHcyase_NAD" amino acids 231 to 390 (160 residues), 269.7 bits, see alignment E=1.5e-84 PF02826: 2-Hacid_dh_C" amino acids 250 to 340 (91 residues), 32.1 bits, see alignment E=1.1e-11

Best Hits

Swiss-Prot: 98% identical to SAHH_RALPJ: Adenosylhomocysteinase (ahcY) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01251, adenosylhomocysteinase [EC: 3.3.1.1] (inferred from 98% identity to rso:RSc0093)

Predicted SEED Role

"Adenosylhomocysteinase (EC 3.3.1.1)" in subsystem Methionine Biosynthesis or Methionine Degradation (EC 3.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>ABZR87_RS04855 adenosylhomocysteinase (Ralstonia sp. UNC404CL21Col)
MNAVTELKHDYLVADIKLADWGRKEIAIAETEMPGLMAIREEFAASQPLKGARIAGSLHM
TIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAIAASGTPVFAFKGESLKEYWDFTHR
IFEWADGGTPNMILDDGGDATLLLHLGAKAEKDASVIAKPTSEEETFLFAAIKEKLAKDA
TFYSRNLDAIKGVTEETTTGVHRLYQMAQRGELRFPAINVNDSVTKSKFDNLYGCRESLV
DGIKRATDVMIAGKVAVVAGYGDVGKGSAQALRALSAQVWVTEIDPICALQAAMEGYRVV
TMDYAAEHGDIFVTCTGNYHVITHDHMAKMKDQAIVCNIGHFDNEIDIASVEKYQWEEIK
PQVDHVIFPDGKKIIILAKGRLVNLGCATGHPSYVMSSSFANQTIAQIELWTEAVKGSNK
YPVGVYTLPKHLDEKVARLQLKKLNAQLTELTDQQAAYIGVSKEGPYKADHYRY