Protein Info for ABZR87_RS04515 in Ralstonia sp. UNC404CL21Col

Annotation: potassium-transporting ATPase subunit KdpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 741 transmembrane" amino acids 81 to 101 (21 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 266 to 291 (26 residues), see Phobius details amino acids 303 to 329 (27 residues), see Phobius details amino acids 639 to 660 (22 residues), see Phobius details amino acids 673 to 694 (22 residues), see Phobius details amino acids 714 to 738 (25 residues), see Phobius details TIGR01497: K+-transporting ATPase, B subunit" amino acids 51 to 735 (685 residues), 1075 bits, see alignment E=0 TIGR01494: HAD ATPase, P-type, family IC" amino acids 118 to 396 (279 residues), 108.9 bits, see alignment E=2.2e-35 amino acids 416 to 663 (248 residues), 149.6 bits, see alignment E=9.9e-48 PF00122: E1-E2_ATPase" amino acids 152 to 255 (104 residues), 69.6 bits, see alignment E=1.7e-23 PF00702: Hydrolase" amino acids 354 to 589 (236 residues), 95.3 bits, see alignment E=6.7e-31

Best Hits

Swiss-Prot: 90% identical to KDPB_RALSO: Potassium-transporting ATPase ATP-binding subunit (kdpB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01547, K+-transporting ATPase ATPase B chain [EC: 3.6.3.12] (inferred from 99% identity to rpf:Rpic12D_3268)

Predicted SEED Role

"Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (741 amino acids)

>ABZR87_RS04515 potassium-transporting ATPase subunit KdpB (Ralstonia sp. UNC404CL21Col)
MAIRYPESEPVVRTVKHKLEPSAGTGTAAAAEPQARSTHTTHTTLSAKDVRKLSMFSSAL
VKPAIVDSFRKLSPRAQAKNPVMFVVYVGSILTTILWGMALRGQAEAPAGFILAVSVWLW
FTVLFANFAEALAEGRSKQQAASLRGIKTTVQAKVLADAGRRDRVEARAATALRRGDIVL
IEAGDMVPGDGEVIEGVASVDESAITGESAPVIRESGGDFSSVTGGTRVLSDWIIVRITA
NPGESFLDRMISMVEGAKRQKTPNELALTILLVSLTIILMLATVTLLPYSIFSVDAMKAG
SPITITVLVALLVCLIPTTIGGLLSAIGVAGMSRMMQANVIATSGRAVEAAGDVDVLLLD
KTGTITHGNRQASRFIPAPGVTAKQLAEAAWLSSLADETPEGRSIVTLARNLGEASIDEA
ALAKTQPVYVAFSAQTRMSGINVSYAGDARQIRKGAADAIRTHVTLLAGKFPDAVSTAVD
DVARAGGTPLVVSDNDRVLGVVELKDIVKAGIRERFAELRQMGIKTVMITGDNRLTAASI
AAEAGVDDFIAEATPETKLALIREQQAQGRLVAMTGDGTNDAPALAQADVAVAMNSGTQA
AKEAGNMVDLDSSPTKLIQIVEIGKQMLMTRGSLTTFSIANDVAKYFAIIPAAFATTYPQ
LAALNVMHLATPASAVMSAVIFNALIIVFLIPLALKGVKYRALGAAALLRRNLLIYGLGG
LLLPFPGIKIIDMFLAAMGWV