Protein Info for ABZR87_RS04230 in Ralstonia sp. UNC404CL21Col

Annotation: Cu(I)-responsive transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 TIGR02044: Cu(I)-responsive transcriptional regulator" amino acids 12 to 137 (126 residues), 195.4 bits, see alignment E=1.6e-62 PF13411: MerR_1" amino acids 13 to 79 (67 residues), 64.8 bits, see alignment E=9.6e-22 PF00376: MerR" amino acids 13 to 50 (38 residues), 66.4 bits, see alignment E=2.3e-22 PF09278: MerR-DNA-bind" amino acids 56 to 119 (64 residues), 79.6 bits, see alignment E=3.2e-26

Best Hits

Swiss-Prot: 59% identical to HMRR2_RHIME: Heavy metal-dependent transcription regulator 2 (hmrR2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 95% identity to rpf:Rpic12D_3216)

Predicted SEED Role

"Cu(I)-responsive transcriptional regulator" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (152 amino acids)

>ABZR87_RS04230 Cu(I)-responsive transcriptional regulator (Ralstonia sp. UNC404CL21Col)
MTRTPLIDKGPVNIGEAAKASGVSAKMIRYYESIGLLPPSPRTEGNYRMYDARALHVLRF
IHRSRSLGFALEEIRTLLSLWNDRERASADVKAVTLRHVADLDARISELQSMRDTLMTLA
NACHGDDRPDCPILQSVAGEGGEGGDADTCCH