Protein Info for ABZR87_RS04095 in Ralstonia sp. UNC404CL21Col

Annotation: F0F1 ATP synthase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00137: ATP-synt_C
  • amino acids 14 to 76 (63 residues), 49.8 bits, E=1.7e-17
• TIGR01260: ATP synthase F0, C subunit
  • amino acids 24 to 80 (57 residues), 70.7 bits, E=4.1e-24

Best Hits

Swiss-Prot: 81% identical to ATPL_LEPCP: ATP synthase subunit c (atpE) from Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)

KEGG orthology group: K02110, F-type H+-transporting ATPase subunit c [EC: 3.6.3.14] (inferred from 95% identity to bvi:Bcep1808_0110)

Predicted SEED Role

"ATP synthase F0 sector subunit c"

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Protein Sequence (88 amino acids)

>ABZR87_RS04095 F0F1 ATP synthase subunit C (Ralstonia sp. UNC404CL21Col)
MQAFLANIQGLTAIGIGIIIGLGAIGACLGIALMGGKYIEACARQPELMNPLQTKMFLLA
GLIDAAFLIGVGVAMLFAFANPLLSVIK