Protein Info for ABZR87_RS03845 in Ralstonia sp. UNC404CL21Col

Annotation: M20/M25/M40 family metallo-hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 PF01546: Peptidase_M20" amino acids 99 to 414 (316 residues), 75.1 bits, see alignment E=7.3e-25 PF07687: M20_dimer" amino acids 208 to 317 (110 residues), 67.3 bits, see alignment E=1.1e-22

Best Hits

KEGG orthology group: None (inferred from 97% identity to rpf:Rpic12D_3143)

Predicted SEED Role

"N-succinyl-L,L-diaminopimelate desuccinylase (EC 3.5.1.18)" in subsystem Arginine Biosynthesis extended or Lysine Biosynthesis DAP Pathway (EC 3.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.18

Use Curated BLAST to search for 3.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (424 amino acids)

>ABZR87_RS03845 M20/M25/M40 family metallo-hydrolase (Ralstonia sp. UNC404CL21Col)
MTQAQLATPGIDADIRAFVDAAHAQQIDFLRELVKVPSDNPSGDCAPHAARAKALLEALG
LTVEAHAVPQAQVRAAGMVSATNLIVRHTFGSGGPTVAMNAHGDVVPPGLGWTHDPYGGE
IVETEHGPTMFGRGVAVSKSDFATYTWALLALIEAEKRGAKLNGTVELHFTYDEETGGDI
GPKWLLDQGLSKPDYAISAGFAYGITSAHNGCLHVQVTVRGRQAHAAMPHTGIDAIEAAT
HILRAVYAYRAELATRKSAVTGIDHATLNVGLIQGGINTNVVPDLVTFRVDRRMIPEEAG
RDAEGELRAVVERAAAERPGIEVSVERILLAEPLAELPGVDALIGALRRNALAVFGGDVP
VHGVPLYTDARHYTAHGVPTVLYGAGPRTLMEARGHNTDENLRLNDLRGATVVVGCAVGE
LLGG