Protein Info for ABZR87_RS03440 in Ralstonia sp. UNC404CL21Col

Annotation: type II secretion system protein GspM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 transmembrane" amino acids 43 to 61 (19 residues), see Phobius details PF04612: T2SSM" amino acids 28 to 183 (156 residues), 146.7 bits, see alignment E=3.6e-47

Best Hits

KEGG orthology group: K02462, general secretion pathway protein M (inferred from 99% identity to rpf:Rpic12D_3050)

Predicted SEED Role

"General secretion pathway protein M"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (189 amino acids)

>ABZR87_RS03440 type II secretion system protein GspM (Ralstonia sp. UNC404CL21Col)
MATSSPSSSRSSSRRLPRIGVPDSVRDAATTFWMQREPRERRILAGGGVVLLLVIVYLVL
WEPAFEGQRRIEKALPQMRTQLAEMETLGQEARGLSAIAAAPVPRGAELQQALTASLTNH
GLKATRMAMSGESVQVQLDKVPFGAVAEWLQEVRQAQRMKVIDTNIKYVGATALVNVTAT
LQGPAAAGR