Protein Info for ABZR87_RS02880 in Ralstonia sp. UNC404CL21Col

Annotation: DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 23 to 631 (609 residues), 788.5 bits, see alignment E=3.8e-241 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 25 to 485 (461 residues), 502.4 bits, see alignment E=1.3e-154 PF00270: DEAD" amino acids 39 to 198 (160 residues), 90.3 bits, see alignment E=3e-29 PF00271: Helicase_C" amino acids 255 to 349 (95 residues), 64.8 bits, see alignment E=2.1e-21 PF16124: RecQ_Zn_bind" amino acids 361 to 422 (62 residues), 71 bits, see alignment E=2.9e-23 PF09382: RQC" amino acids 424 to 538 (115 residues), 124.1 bits, see alignment E=6.2e-40 PF00570: HRDC" amino acids 565 to 630 (66 residues), 73 bits, see alignment E=3.8e-24

Best Hits

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 99% identity to rpi:Rpic_3305)

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (637 amino acids)

>ABZR87_RS02880 DNA helicase RecQ (Ralstonia sp. UNC404CL21Col)
MYDSPAIDHALQALPEDTAAATHAVLHDVFGYSAFRGPQAEIVAHVADGGDCLVLMPTGG
GKSLCYQIPALVRHRRGQGAGIVVSPLIALMQDQVAALEEAGVRAAYLNSALTGAEAAQV
ERDLAAGRLDLVYVAPERLMTPRFLELLERSRIGLFAIDEAHCVSQWGHDFRPEYIQLSV
LHERFPHVPRIALTATADAVTRDEIVERLALTDARVFLSSFDRPNIRYTIVEKDSARQQL
LRFIRAEHMDGDTCDAGIVYCLSRKKVEETAQWLAEQGIRALPYHAGMDSEVRARHQAIF
RKEEGVVMVATIAFGMGIDKPDVRFVAHLDLPKSLEGYYQETGRAGRDGLPANAWMAYGL
ADVVQQRRMIDESDADDVHKRVSTAKLEALLGLCEAATCRRVALLAYFGESSQPCGNCDT
CLTPPQTWDATREAQMALSCAYRVQQASRVSFGAGQLIDILRGNATERIKQWHHETLSTF
GIGSDLSEAAWRSVFRQLVAQGLFAVDHGGHGALILTDAARPVLKGEQPVILRRQAEKVR
GASSSSTKKERRADPAAELSTEAQVRWQALRAWRTQAAREHSVPAYVIFHDATLARIAET
DPDSREALGELPGIGMAKLDRYGQALLDVLEKCREQA