Protein Info for ABZR87_RS02870 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 50 to 75 (26 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 355 to 376 (22 residues), see Phobius details amino acids 382 to 405 (24 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 282 (256 residues), 76.5 bits, see alignment E=9.6e-26 amino acids 228 to 402 (175 residues), 35.1 bits, see alignment E=3.7e-13

Best Hits

Swiss-Prot: 43% identical to YDER_BACSU: Uncharacterized MFS-type transporter YdeR (ydeR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 96% identity to rpi:Rpic_3303)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>ABZR87_RS02870 MFS transporter (Ralstonia sp. UNC404CL21Col)
MTTEAPAIPNTSLADALPRGATPLFAAAVGLIVINLFGIQPLVAEIAASIGWTTAATGLL
VTATLVGYGIGLLLLMPLTDLQDNRALASRTLWGAVASLALTTVAQSGQVLMLAAFAIGL
TSTVIQMLIALAGRLSADHRRGRVLGDIMIGLNLGILLSRPAASLIAAQWGWRAFYGASA
VAIAVLAVLLPRVMPTFVPPRALSYGVLLKSYGHLLRSEPVLRRRAATQALLMAAFTLFW
TAVALRLAAAPFHLSQNGIGIFALCGAAGVVAAPIAGRLADRGLVRVGTLLAHGSAATGL
LLALASALLPGLSVPVMLVMLAAAALLLDFGAIGDQALGRYMVNTLSPEVRGRVNGLYTG
AFFFGAAAGGGLAGAAWARAGWIGVSVLALGFVVAAALVFVWPAGAQRAIGATPRRC