Protein Info for ABZR87_RS02645 in Ralstonia sp. UNC404CL21Col

Annotation: protein-methionine-sulfoxide reductase heme-binding subunit MsrQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 85 to 102 (18 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details PF01794: Ferric_reduct" amino acids 52 to 166 (115 residues), 64.3 bits, see alignment E=5.5e-22

Best Hits

Swiss-Prot: 85% identical to MSRQ_RALSO: Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (msrQ) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: None (inferred from 99% identity to rpf:Rpic12D_2911)

Predicted SEED Role

"FIG001196: Membrane protein YedZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>ABZR87_RS02645 protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (Ralstonia sp. UNC404CL21Col)
MTLLPPMLAPKPLRVVKAIAWIVALLPFLRIVFLGATDQFGANPLEFVTRSTGTWTLVLL
CCTLAITPLRRITGMNWLIRLRRMLGLYTFFYGTIHFLIWLLVDRGLDPASMLKDIVKRP
FITVGFAAFVLMIPLAATSTNAMVRRLGGKRWQWLHRLVYVTGVLGILHYWWHKAGKHDF
AEVSIYAAVMAVLLGLRVWWAWRSQRSAMTGAAMPARD