Protein Info for ABZR87_RS02630 in Ralstonia sp. UNC404CL21Col

Annotation: iron donor protein CyaY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 PF01491: Frataxin_Cyay" amino acids 3 to 105 (103 residues), 87.9 bits, see alignment E=2.3e-29 TIGR03421: iron donor protein CyaY" amino acids 6 to 110 (105 residues), 117.4 bits, see alignment E=1.3e-38

Best Hits

Swiss-Prot: 97% identical to CYAY_RALPJ: Iron-sulfur cluster assembly protein CyaY (cyaY) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K06202, CyaY protein (inferred from 96% identity to rpf:Rpic12D_2908)

Predicted SEED Role

"Frataxin homolog CyaY, facilitates iron supply for heme A synthesis or Fe-S cluster assembly" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (114 amino acids)

>ABZR87_RS02630 iron donor protein CyaY (Ralstonia sp. UNC404CL21Col)
MPPLSESEFLALAEAELSRIESIVETAADEADADIEVNRTGNVLTLEFDDGSKIIINSQA
PMQELWVAARAGGFHFRRGDDGRWVDTRSKEELYVALSRYVSQQSDVDVTLAAS