Protein Info for ABZR87_RS02550 in Ralstonia sp. UNC404CL21Col

Annotation: lipid asymmetry maintenance ABC transporter permease subunit MlaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 146 to 175 (30 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 19 to 254 (236 residues), 268.3 bits, see alignment E=4.1e-84 PF02405: MlaE" amino acids 40 to 252 (213 residues), 249.8 bits, see alignment E=1.1e-78

Best Hits

Swiss-Prot: 58% identical to MLAE_HAEIN: Intermembrane phospholipid transport system permease protein MlaE (mlaE) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 98% identity to rpf:Rpic12D_2892)

Predicted SEED Role

"Uncharacterized ABC transporter, permease component YrbE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>ABZR87_RS02550 lipid asymmetry maintenance ABC transporter permease subunit MlaE (Ralstonia sp. UNC404CL21Col)
MISTIGRFVLVLISRFGYAARTLISLIAASGDVLRRPRLVVEQLRFVGNDSFIIIAVSGL
FVGFVLGLQGYNTLNRYGSEQALGLLVALSLVRELGPVVTALLFAGRAGTSLTAEIGLMK
AGEQLIAMEMMAVDPLARVLAPRFWAGFIAMPLLAAIFSAVGILGGYFVGVGLIGVDPGA
FWSQMQAGVDVMDDVLNGVIKSFVFGVAVTFIALYQGYEAKATPEGVSRATTRTVVIASL
TVLALDFVLTALMFS