Protein Info for ABZR87_RS02430 in Ralstonia sp. UNC404CL21Col

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 603 transmembrane" amino acids 28 to 51 (24 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 320 to 346 (27 residues), see Phobius details amino acids 381 to 403 (23 residues), see Phobius details amino acids 423 to 444 (22 residues), see Phobius details amino acids 475 to 499 (25 residues), see Phobius details amino acids 523 to 542 (20 residues), see Phobius details amino acids 567 to 595 (29 residues), see Phobius details PF00528: BPD_transp_1" amino acids 98 to 293 (196 residues), 43.9 bits, see alignment E=1.2e-15 amino acids 399 to 591 (193 residues), 35.5 bits, see alignment E=4.2e-13

Best Hits

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 98% identity to rpi:Rpic_3215)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (603 amino acids)

>ABZR87_RS02430 iron ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MRSLAQDRAAARQVSPKRSPWTRVGQALPRGVVILLTALAIFTPLALIFYQSFLSAPFFM
PDALAGLDAYRFIFTDSDFWHAFEKSAALAFGLAVISVPLGGILAFLMVRSDLPGRRILE
PLLMIPVFVSPMVLAFGYVVSAGPVGFYTVWFKSLFGGAPWNVYSFTSIIIIAGLTHVPH
VYLYVSSALRSLGSDVEEAARIAGASPLSVALNVSLPMVRPALLYAAVLVTFLGFEVFGL
VLVLGDPEGHLVLATYLYKLTNKLGTPAYHLMAAVAVCLVMVTFPLVLLQRYMLKSANRF
VTVKGKVTRSRPLPLGSWRWPAWAVVVLWFFVTVVVPLSGIALRAFVSNWGEGVSLVEAF
STTAFQQIFAQPQFLRAMVNTVLIGVIGGALAVGCYTCIGLAMHRKPDGWTRFLDYSVLV
PRAIPGLLAGLAFLWVFLFVPNWIETGLTDSGLPFANWIIENIVPSLRDLRSTIFSVWIA
YTVVWLAYGLRLISAALLQVGPELEEAARSVGATRARTTRDVTVPLTRYGLLGAWLLIFL
IFEREYSTGVYLLSPGTETIGSMLVSLWAGGAIDIVAALSFVNIVLVAVGLGIALRFGVK
LHD