Protein Info for ABZR87_RS02400 in Ralstonia sp. UNC404CL21Col

Annotation: Do family serine endopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02037: peptidase Do" amino acids 62 to 388 (327 residues), 440 bits, see alignment E=4.8e-136 PF00089: Trypsin" amino acids 116 to 276 (161 residues), 78 bits, see alignment E=2.8e-25 PF13365: Trypsin_2" amino acids 118 to 252 (135 residues), 125.8 bits, see alignment E=6.8e-40 PF00595: PDZ" amino acids 291 to 367 (77 residues), 36 bits, see alignment E=2.2e-12 PF13180: PDZ_2" amino acids 293 to 380 (88 residues), 58.2 bits, see alignment E=2.6e-19 PF17820: PDZ_6" amino acids 318 to 360 (43 residues), 48.7 bits, see alignment 1.5e-16

Best Hits

KEGG orthology group: None (inferred from 99% identity to rpi:Rpic_3209)

Predicted SEED Role

"Outer membrane stress sensor protease DegS" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>ABZR87_RS02400 Do family serine endopeptidase (Ralstonia sp. UNC404CL21Col)
MLRRFWLFFAQAVTVVLAVWFVIATLKPDWLQRGKVAVQSGSPIVALKEVAPIGHGGTSS
NSYAEAAKVAMPAVVNIFSSKNAPKRGSNPQASADPWFRFFFGDRAPEQRQEPTASLGSG
VIVSSEGYILTNHHVVDGADEIEVALTDGRKANAKVVGSDPETDLAVLKINLPNLPAITL
GRLENVRVGDVVLAIGNPFGVGQTVTMGIVSALGRSHLGINTFENFIQTDAAINPGNSGG
ALVDADGNLLGINTAIYSRSGGSLGIGFAIPVSLAKQVMESIISTGSVVRGWIGVEPQDV
TPEIAESFGLSRKDGALIAAVVQGGPADKAGLRPGDILTSVNGEPILDTTALLNSIAQLK
PGAEAKVTVSRKGKAVELTIVVGKRPAPTRRNVPMPSQDDEEQQ