Protein Info for ABZR87_RS02065 in Ralstonia sp. UNC404CL21Col

Annotation: M20 aminoacylase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01891: amidohydrolase
  • amino acids 16 to 380 (365 residues), 378.6 bits, E=1.6e-117
• PF01546: Peptidase_M20
  • amino acids 72 to 390 (319 residues), 167.8 bits, E=3.2e-53
• PF07687: M20_dimer
  • amino acids 184 to 277 (94 residues), 40.5 bits, E=2.4e-14

Best Hits

Swiss-Prot: 46% identical to HIPO_CAMJE: Hippurate hydrolase (hipO) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

KEGG orthology group: K01451, hippurate hydrolase [EC: 3.5.1.32] (inferred from 99% identity to rpi:Rpic_3113)

MetaCyc: 39% identical to N-acetyl amino acid acetylase (Bacillus subtilis subtilis 168)
3.5.1.-

Predicted SEED Role

"Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit A" in subsystem p-Aminobenzoyl-Glutamate Utilization

MetaCyc Pathways

• S-(2-succinyl)-L-cysteine degradation (2/4 steps found)
• S-benzyl-L-cysteine degradation (1/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Phenylalanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.32

Use Curated BLAST to search for 3.5.1.32

Protein Sequence (395 amino acids)

>ABZR87_RS02065 M20 aminoacylase family protein (Ralstonia sp. UNC404CL21Col)
MKLIPEIQAAQPEIQALRRDIHAHPELCFEEQRTSDLVAAKLAEWGIEVHRGLGKTGLVG
VIRNGEGKSIGLRADMDALPLAEANQFEHRSKHDGKMHACGHDGHTAMLLGAAHYLAKHR
NFSGTVNLIFQPAEEGGGGAREMIKDGLFDRFPCDAVFGLHNWPGVPVGAFGTRAGALMA
SSNEFRITIKGKGAHAALPHNGNDPVFVGAQVVSALQGIITRNKRPIDTAVLSVTQFHAG
DATNIIPNEAWIGGTVRTFSTEVLDLIERRMEEVSKGIASAYDCTVDFVFHRNYPPTVNT
EAETQFAAAVMRELVGVDNVDANIDPTMGAEDFSFMLIEKPGCFAFIGNGDGDHREQGHG
LGPCMLHNPSYDFNDELLPLGATYWVRLVEKFLAT