Protein Info for ABZR87_RS01990 in Ralstonia sp. UNC404CL21Col

Annotation: 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinone monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF03232: COQ7" amino acids 54 to 214 (161 residues), 169 bits, see alignment E=7.6e-54

Best Hits

Swiss-Prot: 94% identical to COQ7_RALPJ: 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (coq7) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K06134, ubiquinone biosynthesis monooxygenase Coq7 [EC: 1.14.13.-] (inferred from 95% identity to rpf:Rpic12D_2734)

MetaCyc: 61% identical to 3-demethoxyubiquinol 3-hydroxylase (Xanthomonas campestris pv. campestris)
OCTAPRENYL-METHYL-METHOXY-BENZOQ-OH-RXN [EC: 1.14.99.60]

Predicted SEED Role

"2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (EC 1.14.13.-)" in subsystem Ubiquinone Biosynthesis (EC 1.14.13.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.99.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>ABZR87_RS01990 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinone monooxygenase (Ralstonia sp. UNC404CL21Col)
MLDRFLSEFDRALRAVAGVTRASRPNPADAVIASAASADTADAAAKLAEADRRHAAGLMR
VNHVGEVCAQALYQGQALFARDPAIRAQLDEAAREEEDHLAWCAQRLQELNDRPSLLNPL
WYAGAFAIGAVAGRLGDKISLGFVAETERQVEHHLDGHLDKLPEQDSRSRAIVAQMRDDE
IRHGDNARQAGGIELPAPIRQAMRAASRVMTATAYRI