Protein Info for ABZR87_RS01965 in Ralstonia sp. UNC404CL21Col

Annotation: UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 transmembrane" amino acids 326 to 335 (10 residues), see Phobius details TIGR01085: UDP-N-acetylmuramyl-tripeptide synthetase" amino acids 32 to 507 (476 residues), 492.8 bits, see alignment E=5.7e-152 PF08245: Mur_ligase_M" amino acids 123 to 331 (209 residues), 174.2 bits, see alignment E=3.5e-55 PF02875: Mur_ligase_C" amino acids 354 to 483 (130 residues), 120.7 bits, see alignment E=7.5e-39

Best Hits

Swiss-Prot: 89% identical to MURE_RALSO: UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (murE) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01928, UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [EC: 6.3.2.13] (inferred from 96% identity to rpi:Rpic_3094)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC 6.3.2.13)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (514 amino acids)

>ABZR87_RS01965 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase (Ralstonia sp. UNC404CL21Col)
MTAKPTSDRPTIAARLAPVVDWLRVQAPAGANLTSDTRKLKTGDVFVAYVLGNVRQHGDG
RPHIPQAIEAGASAVLAEAHGYAMPADAPVRILPVDGLAELAGPLAAQWYGVPGSEALRV
IGVTGTNGKTSCSQWIAQALTKHGERCAVVGTLGTGFVDALAATGFTTPDAIQLQRSLAD
LHRAGARAIAMEVSSHGLEQGRVDGTCFDIAVFTNLTQDHLDYHGTMAEYELAKARLFSW
PGLRAAVINRDDAAGVRLLQNARAEVETIEYGIDGEAAAQHGARQWLRASNVRAHRTGTT
FDVDGSFGRATVHAPTVGLFNVSNLLGVLGALLAAGVPWQDAIARLEKLQPVSGRMERFG
GEDGPLVVVDYAHTPDALEQTLRALAPITEARGGKLWAVFGCGGDRDPGKRPQMGAIAER
LAPHVVLTSDNPRSEDPQHILDEIADGMDNPRAATQIEDRAAAILHAVRHADAHDVIVVA
GKGHESTQEIAGRKRPFSDQEHVRLALAARGVNA