Protein Info for ABZR87_RS01280 in Ralstonia sp. UNC404CL21Col

Annotation: tRNA guanosine(34) transglycosylase Tgt

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 TIGR00449: tRNA-guanine family transglycosylase" amino acids 4 to 376 (373 residues), 496.9 bits, see alignment E=3.3e-153 TIGR00430: tRNA-guanine transglycosylase" amino acids 4 to 376 (373 residues), 519 bits, see alignment E=6.6e-160 PF01702: TGT" amino acids 11 to 378 (368 residues), 529.3 bits, see alignment E=2.4e-163

Best Hits

Swiss-Prot: 98% identical to TGT_RALPJ: Queuine tRNA-ribosyltransferase (tgt) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K00773, queuine tRNA-ribosyltransferase [EC: 2.4.2.29] (inferred from 99% identity to rpf:Rpic12D_2547)

MetaCyc: 62% identical to tRNA-guanine transglycosylase (Escherichia coli K-12 substr. MG1655)
tRNA-guanine transglycosylase. [EC: 2.4.2.29]

Predicted SEED Role

"tRNA-guanine transglycosylase (EC 2.4.2.29)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 2.4.2.29)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>ABZR87_RS01280 tRNA guanosine(34) transglycosylase Tgt (Ralstonia sp. UNC404CL21Col)
MLKYELLTTDGLARRGRMTLNHGVVETPIFMPVGTYGAVKAMSPAELKDIGAQIILGNTF
HLWLRPGLEVMDAHKGLHGFNGWDKPILTDSGGFQVFSLGDLRKITEEGVTFASPINGDK
LFLSPEISMQIQRRLNSDIVMQFDECTPYKIGDRPATEAEAAASMRMSLRWAQRSRNEFA
RENNPNALFGIVQGGMFEHLRDESLAGLQAIDADAGGEGFGGYAIGGLSVGEPKEDMMRV
LQHVAPRLPANKPHYLMGVGTPEDLVAGVASGVDMFDCVMPTRNARNGWLFTRFGDIKIK
NAVHRNDPRPLDETCGCYTCSNFSRAYLHHLQRVGEILGARLNTIHNLYYYLELMAEMRA
AIESHGFGAFQARFAADRARGAL