Protein Info for ABZR87_RS01140 in Ralstonia sp. UNC404CL21Col

Annotation: ion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 48 to 66 (19 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 233 to 257 (25 residues), see Phobius details PF00520: Ion_trans" amino acids 47 to 259 (213 residues), 110.2 bits, see alignment E=9.9e-36 PF07885: Ion_trans_2" amino acids 181 to 257 (77 residues), 51.1 bits, see alignment E=1e-17

Best Hits

KEGG orthology group: None (inferred from 75% identity to rme:Rmet_2927)

Predicted SEED Role

"Potassium voltage-gated channel subfamily KQT; possible potassium channel, VIC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>ABZR87_RS01140 ion transporter (Ralstonia sp. UNC404CL21Col)
MSQNPSRTSRWHAHNTRLAAYLGKPEEDGWRRRWYVIIFEAETRSGRLFDLTLLGAILAS
VLVVMLDSLPSVSGRAGTLFTVLEWLFTLLFTAEYVMRILVVRKPWRYVLSFYGVIDFIS
ILPTWLAIFVPELAYLLDVRLLRLLRIFRILKITVYFEEAQILLRALVNARRKIFVFLGT
VFIITIILGTVMYVVEGPQHGFTSIPVSMYWAVVTLTTTGFGDLVPKTPLGQFITSMTIL
LGYSIIAFPTGIIGAELVNTMRDGSSSTPSPTPPSPSTRACTGCTFDRHDIDAAFCKRCG
TRLPLPPTETAPSQ