Protein Info for ABZR87_RS01120 in Ralstonia sp. UNC404CL21Col

Annotation: cob(I)yrinic acid a,c-diamide adenosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 PF01923: Cob_adeno_trans" amino acids 8 to 165 (158 residues), 195.6 bits, see alignment E=3.4e-62 TIGR00636: ATP:cob(I)alamin adenosyltransferase" amino acids 10 to 178 (169 residues), 215.1 bits, see alignment E=2.7e-68

Best Hits

Swiss-Prot: 78% identical to ATR_CUPMC: Cobalamin adenosyltransferase (cobO) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K00798, cob(I)alamin adenosyltransferase [EC: 2.5.1.17] (inferred from 99% identity to rpf:Rpic12D_2493)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.17

Use Curated BLAST to search for 2.5.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (185 amino acids)

>ABZR87_RS01120 cob(I)yrinic acid a,c-diamide adenosyltransferase (Ralstonia sp. UNC404CL21Col)
MGNRLSKIATRTGDDGTTGLGDGSRTAKDSLRIAAIGDVDELNSHIGVLLTESLPDGVRA
ALTAIQHDLFDLGGELCIPGYTMVTTAHVLRLDQWLADYNADLPRLAEFILPGGSRAAAQ
AHVCRTVARRAERSIVALGRAETIGEAPRQYVNRLSDLLFVLARVLNRADGGTDVLWKRD
EHKPA