Protein Info for ABZR87_RS01040 in Ralstonia sp. UNC404CL21Col

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 218 to 245 (28 residues), see Phobius details amino acids 254 to 276 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 113 to 282 (170 residues), 90.8 bits, see alignment E=4.6e-30

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 98% identity to rpi:Rpic_2883)

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>ABZR87_RS01040 ABC transporter permease subunit (Ralstonia sp. UNC404CL21Col)
MSALETPVLQRASADAAPPSSRPARRLRGYRLPGEGSALGLSVLSVTALLVLWWAATTFH
WVPPLFLPSPQAVGRAFIDAWHGDIQGGQPLASHLGWSALRVFGAFALAAVTAIPIGLAM
GVSRTARGLLDPPIEFYRPLPPLAYLPLVVIWLGIDERAKIVVIYLACFAPIAMAARAGV
RSATLEQINAAYALGASFTQVVRHVILPAALPEILTGLRIAIGFGWTTLVAAEMVAATVG
VGQMVLNASSFLRTDLVVMGIVLIGAIAWAFDLAMRAIEARVVPWKGRS