Protein Info for ABZR87_RS00935 in Ralstonia sp. UNC404CL21Col

Annotation: polynucleotide adenylyltransferase PcnB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 TIGR01942: poly(A) polymerase" amino acids 58 to 502 (445 residues), 486.5 bits, see alignment E=3.4e-150 PF01743: PolyA_pol" amino acids 87 to 236 (150 residues), 117.4 bits, see alignment E=8.1e-38 PF12627: PolyA_pol_RNAbd" amino acids 263 to 325 (63 residues), 77 bits, see alignment E=1.1e-25 PF12626: PolyA_pol_arg_C" amino acids 377 to 501 (125 residues), 149.1 bits, see alignment E=8.3e-48

Best Hits

KEGG orthology group: K00970, poly(A) polymerase [EC: 2.7.7.19] (inferred from 98% identity to rpf:Rpic12D_2456)

Predicted SEED Role

"Poly(A) polymerase (EC 2.7.7.19)" in subsystem Polyadenylation bacterial (EC 2.7.7.19)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (520 amino acids)

>ABZR87_RS00935 polynucleotide adenylyltransferase PcnB (Ralstonia sp. UNC404CL21Col)
MIKKLINRLLGKTSAEPTVPAEPGAPAARKARTPKAAKTAKARTKSAGGVPRQARVWSVD
EHGIDPKLLSRNAVKVTSTLQDAGYAAFIVGGAVRDLLLGIKPKDFDVATNATPDQVQAL
FRRSRIIGRRFQIVHVTFYGGRDQEIIEVSTFRALVDAVDAEQVPAGKRVKRTELDHHTH
AVDASGRVLRDNVWGTQAEDATRRDFTVNAMYYNPADETVHDYHHGMEDMRARTLRMIGD
PHTRYREDPVRMLRVVRFAAKTGFDIDPDTRAPIAELGPLIHNVPAARLFDEMLKLLMSG
HAWASLQELRKAGLHRGLLPLLDVALEQPMGQRFVQLALDNTDDRVKAGKPVSPGFLFAS
LLWHHVVEHWNRRRAAGEPLIPALHTAMDEVLDRQTEQLAIQRRFTSDMKEIWSMQPRFE
KRSGRMPYRLLESPRFRAGYDFLVLRCASGELPQELADWWTDFQNGDGEAREALMAQAKH
APSPSANAGPASPGKRRRRRRGPAKSDTVGDVNPGSSEET