Protein Info for ABZR87_RS00080 in Ralstonia sp. UNC404CL21Col

Annotation: cob(I)yrinic acid a,c-diamide adenosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 PF12557: Co_AT_N" amino acids 5 to 29 (25 residues), 40.7 bits, see alignment (E = 1.7e-14) TIGR00708: cob(I)yrinic acid a,c-diamide adenosyltransferase" amino acids 34 to 205 (172 residues), 215.3 bits, see alignment E=2.5e-68 PF02572: CobA_CobO_BtuR" amino acids 36 to 205 (170 residues), 213.1 bits, see alignment E=3.3e-67

Best Hits

Swiss-Prot: 71% identical to COBO_PSEAE: Corrinoid adenosyltransferase (cobO) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00798, cob(I)alamin adenosyltransferase [EC: 2.5.1.17] (inferred from 97% identity to rpi:Rpic_2664)

MetaCyc: 52% identical to CobO (Pseudomonas denitrificans (nom. rej.))
Cob(I)yrinic acid a,c-diamide adenosyltransferase. [EC: 2.5.1.17]

Predicted SEED Role

"Cob(I)alamin adenosyltransferase (EC 2.5.1.17)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.5.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.17

Use Curated BLAST to search for 2.5.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>ABZR87_RS00080 cob(I)yrinic acid a,c-diamide adenosyltransferase (Ralstonia sp. UNC404CL21Col)
MTTEDNNDGLNERHRSRMQRKKAVVDAKIAAATDVRGLLLVNTGNGKGKSSSGFGMVIRA
MGHDMQVGVVQFIKGAIPTGEERFLRRFPEQCRFHVMGEGYTWETQDRTRDIEKAQAAWA
CARELLSDPTIGLVLLDELNIALKYHYLDVQTVLADLRARPSAQHVVITGRGAPPELIDA
ADTVTDMTLVKHAFSQGIQAQPGVEL