Protein Info for ABZR86_RS21635 in Dyella japonica UNC79MFTsu3.2

Annotation: 3-hydroxyacyl-ACP dehydratase FabZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01750: beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  • amino acids 13 to 152 (140 residues), 192 bits, E=2.1e-61
• PF07977: FabA
  • amino acids 21 to 146 (126 residues), 120 bits, E=3.1e-39

Best Hits

Swiss-Prot: 60% identical to FABZ_XANCB: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (fabZ) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K02372, 3R-hydroxymyristoyl ACP dehydrase [EC: 4.2.1.-] (inferred from 60% identity to xcc:XCC1362)

MetaCyc: 46% identical to beta-hydroxyacyl-[acyl carrier protein] dehydratase (Bacillus subtilis subtilis 168)
3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase. [EC: 4.2.1.59]

Predicted SEED Role

"3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)" (EC 4.2.1.59)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• palmitate biosynthesis III (28/29 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• anteiso-branched-chain fatty acid biosynthesis (30/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (23/25 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (12/12 steps found)
• biotin biosynthesis I (14/15 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• 8-amino-7-oxononanoate biosynthesis I (10/11 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (25/205 steps found)
• superpathway of mycolate biosynthesis (26/239 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Nucleotide sugars metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.- or 4.2.1.59

Sequence Analysis Tools

See A0A1I2IYQ7 at UniProt or InterPro

Protein Sequence (157 amino acids)

>ABZR86_RS21635 3-hydroxyacyl-ACP dehydratase FabZ (Dyella japonica UNC79MFTsu3.2)
MSDKTVPFHLPVTVEQIQNLLPHRYPFLLVDRVIELDPDHRVVGLKNVTMNEPFFQGHFP
GHPVMPGVLIVEAMAQTAGLLTQISSRLKGDTGSPLFYLAKVDDARFYSPVVPGDQLHME
VKLLRLLRGMGMFEAESRVNGKKVASCQLVCAARSDK