Protein Info for ABZR86_RS20390 in Dyella japonica UNC79MFTsu3.2

Annotation: SpoIIE family protein phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 768 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 292 to 313 (22 residues), see Phobius details PF00672: HAMP" amino acids 313 to 364 (52 residues), 45.6 bits, see alignment 1.5e-15 PF07228: SpoIIE" amino acids 432 to 622 (191 residues), 166.7 bits, see alignment E=1.3e-52 PF13581: HATPase_c_2" amino acids 638 to 763 (126 residues), 74 bits, see alignment E=2.2e-24

Best Hits

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2C3I4 at UniProt or InterPro

Protein Sequence (768 amino acids)

>ABZR86_RS20390 SpoIIE family protein phosphatase (Dyella japonica UNC79MFTsu3.2)
MVLRSIASRLAVWVLAGTLLVVVAGGLLLFRVVRQQILEQTHRESAVLAGDVSHRIQHRL
DKVADTAQMLAALIGPRPDDAEPLIRDALAHNADLDGLAAAYVPASIDARAPVRSPFVSR
HLDGSLSVRDLLKDPAPYWTQAWFATGLACATGCWQQPFFSQSRQRRLVNYSAAIEAGGR
PVGVLNADVTLEWLQGVLQALNKPRDTEAFVIDQQGVYLAVEGSALAGQRAQDELIAALR
GDPAEPIRHTGLLATHANAPVWIYHAPIDGTHWQFGLVVPEERIYGGVRRTFSVALSVGA
LALLSLTLLTLVVTRRVLSPLGVLTERAEQVAKGALDFELPRVRRRDEVGRLTHAFDRMR
HELADHLAELGRVAREQQRLASELEIAQQIQTALLPGAHFLDARCNNFELHAVLKPARTV
GGDLYSYFMLHDQRFYIMVGDVSDKGIPAALFMARAITLAKALAPRAQSPQQLLQLLNQE
LCRNNDGCMFVSLLCGLLDTATGHFSMASAGHEPPVLWGEGAPQLLEIETGPALGLDDEA
TYSSRRVRLRPGETLLMYTDGITEATDAELRMYGPERMLDCLGRYAAHGDGDPAGYLLAD
VEAFAAGHGQADDITVLALRWHHAGADGGASMLELTMPASIEAVFDALARCEEQLAAAGV
AQGVRGDVRLVLEELMVNMAEHGRPHTGAARIELRMTLATDAVLVDLHHDGVPFNPLLSP
EPLLTGDVADREIDGGLGIHLVRAMASDFSYAHDEEGNHLQLRFILPT