Protein Info for ABZR86_RS18605 in Dyella japonica UNC79MFTsu3.2

Annotation: thiol peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 PF08534: Redoxin" amino acids 20 to 162 (143 residues), 124.7 bits, see alignment E=2.8e-40 PF00578: AhpC-TSA" amino acids 21 to 145 (125 residues), 63.4 bits, see alignment E=2.1e-21

Best Hits

Swiss-Prot: 73% identical to TPX_PSEAE: Thiol peroxidase (tpx) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K11065, thiol peroxidase, atypical 2-Cys peroxiredoxin [EC: 1.11.1.15] (inferred from 76% identity to pmk:MDS_2338)

MetaCyc: 68% identical to lipid hydroperoxide peroxidase (Escherichia coli K-12 substr. MG1655)
1.11.1.15-RXN [EC: 1.11.1.24]

Predicted SEED Role

"Thiol peroxidase, Tpx-type (EC 1.11.1.15)" in subsystem Thioredoxin-disulfide reductase (EC 1.11.1.15)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2G896 at UniProt or InterPro

Protein Sequence (165 amino acids)

>ABZR86_RS18605 thiol peroxidase (Dyella japonica UNC79MFTsu3.2)
MSTVTLKGNPVQVDGRFPALGSKAPAFTLVAKDLSNVALSSFAGKRKVLNIFPSIDTPTC
ATSVRRFNEQAASLKDAVVLCISADLPFAQARFCGAEGLDNVVTLSTLRGGEFLRDYGVA
LASGPLAGLAARAVVVLDQNDKVLHAEMVSEIAHEPDYDAALKVL