Protein Info for ABZR86_RS17745 in Dyella japonica UNC79MFTsu3.2

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01738: DLH" amino acids 66 to 171 (106 residues), 36.2 bits, see alignment E=1.4e-12 PF00561: Abhydrolase_1" amino acids 69 to 321 (253 residues), 27.4 bits, see alignment E=8e-10 PF12697: Abhydrolase_6" amino acids 86 to 320 (235 residues), 29 bits, see alignment E=5e-10 PF00326: Peptidase_S9" amino acids 120 to 180 (61 residues), 22.6 bits, see alignment E=2e-08

Best Hits

KEGG orthology group: K06889, (no description) (inferred from 76% identity to xfa:XF1745)

Predicted SEED Role

"Dienelactone hydrolase and related enzymes"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2J220 at UniProt or InterPro

Protein Sequence (340 amino acids)

>ABZR86_RS17745 alpha/beta hydrolase (Dyella japonica UNC79MFTsu3.2)
MKKHLLLAVMLATASPFIAMGQDMSNGANNFYKSDRVTSQRIAFDNQYKMKVVGNLFVPQ
HLDRGTKHPAIVVGHPFGAVKEQSANLYAQKLAEQGFVTLSLDLSFWGESDGQPRNAVLP
DVYAEDFSAALDFLGTQSFIDRERIGVLGICAGGGFVISAAKIDPRMKAIATVAMVDMGS
AARSLTTLEQRKKITAEAAAQRWVEFSGGKAEYTGGTVNELTVDTPAMQREFYDFYRTPR
GEYTPAGASPATTTHPTLTSNVKFLNFYPLNDIDAISPRPMLFISGDQSFSRGFSEEAYR
RADQPKELYWVKGAGHVDLYDRVDLIPWEKLTSFFKTNLR