Protein Info for ABZR86_RS17065 in Dyella japonica UNC79MFTsu3.2

Annotation: 50S ribosomal protein L11 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 TIGR00406: ribosomal protein L11 methyltransferase" amino acids 3 to 291 (289 residues), 255.9 bits, see alignment E=2.7e-80 PF06325: PrmA" amino acids 3 to 297 (295 residues), 335.6 bits, see alignment E=4.6e-104 PF05175: MTS" amino acids 150 to 217 (68 residues), 32.8 bits, see alignment E=7.7e-12 PF13847: Methyltransf_31" amino acids 165 to 213 (49 residues), 27.6 bits, see alignment 3.5e-10

Best Hits

Swiss-Prot: 61% identical to PRMA_XANAC: Ribosomal protein L11 methyltransferase (prmA) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 61% identity to xac:XAC0526)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2HRY0 at UniProt or InterPro

Protein Sequence (300 amino acids)

>ABZR86_RS17065 50S ribosomal protein L11 methyltransferase (Dyella japonica UNC79MFTsu3.2)
MPFLELTLTIRSEQQPRVEEALEDIGALSVTLQDADAETPDEQAIFEPGVGELPLWPTIT
LNALFDEHTDRRGLTEALGELLPWLEPDQVQYRDIADQDWERAWMDTFKPMQFGRRLWIY
PWNIEPPADDDAVVVRLDPGLAFGSGTHPTTALCLEWLDAQALQGRSVIDYGCGSGILAI
AALKLGAASAVGVDNDPQALTASADNAERNEVAERLALFLPEDHDVEPADVFVANILAGP
LAELAPTFAAAARPGAPFAISGILKGQEDELLERYAEWFEELRADTREDWVRISGRRRQA