Protein Info for ABZR86_RS15980 in Dyella japonica UNC79MFTsu3.2

Updated annotation (from data): homoserine kinase (EC 2.7.1.39)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR00191.
Original annotation: homoserine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR00191: homoserine kinase" amino acids 15 to 284 (270 residues), 171.5 bits, see alignment E=9.6e-55 PF00288: GHMP_kinases_N" amino acids 90 to 156 (67 residues), 44.2 bits, see alignment E=2.1e-15 PF08544: GHMP_kinases_C" amino acids 219 to 291 (73 residues), 46 bits, see alignment E=5.7e-16

Best Hits

Swiss-Prot: 67% identical to KHSE_XANCP: Homoserine kinase (thrB) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K00872, homoserine kinase [EC: 2.7.1.39] (inferred from 70% identity to psu:Psesu_1250)

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2JN98 at UniProt or InterPro

Protein Sequence (318 amino acids)

>ABZR86_RS15980 homoserine kinase (EC 2.7.1.39) (Dyella japonica UNC79MFTsu3.2)
MARSPQRALSAQALAPASVGNVGIGFDILGHSVAGAGDRARVRRIDEPVVRIAAIEGCVV
DLPLDPAQNTAGMALMALRKALGLRHGFELVLHKGIALGSGMGGSASSCVAALVAANALL
ERPLPMESLYGFALEGEAVASGGRHGDNVGPMLLGGLVLATRDRLVRVPVPDAWHCALVH
PHMVLETRKARAALAGAYQLGEFVAQSANLSLMLAGCWQGDAGLVREGLNDVLVEPRRAP
LIPGFARVKQAAMDHRAMGASISGAGPSVFGWFEQRDEAKAAAAAMAAAFAEAGLDSDTL
VSPIAGPSAALIDVERKA