Protein Info for ABZR86_RS15430 in Dyella japonica UNC79MFTsu3.2

Annotation: winged helix-turn-helix transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 transmembrane" amino acids 123 to 142 (20 residues), see Phobius details PF00486: Trans_reg_C" amino acids 28 to 100 (73 residues), 55.4 bits, see alignment E=2.3e-18 PF13432: TPR_16" amino acids 217 to 267 (51 residues), 18.5 bits, see alignment 1.1e-06 amino acids 349 to 402 (54 residues), 22.9 bits, see alignment 4.6e-08 PF07719: TPR_2" amino acids 236 to 267 (32 residues), 26.6 bits, see alignment (E = 1.9e-09) PF13181: TPR_8" amino acids 236 to 267 (32 residues), 15.5 bits, see alignment (E = 6.9e-06) PF13431: TPR_17" amino acids 256 to 288 (33 residues), 23.1 bits, see alignment (E = 2.7e-08)

Best Hits

Predicted SEED Role

"FIG01211965: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2GLZ5 at UniProt or InterPro

Protein Sequence (525 amino acids)

>ABZR86_RS15430 winged helix-turn-helix transcriptional regulator (Dyella japonica UNC79MFTsu3.2)
MDPSPHYRLLDLHIDTARQRVTRDGNALDVQGLNFQLLACLLRHGDAVVDFDTLMAEVWA
PAVVNEETVTQRVKLLRQALGDDGRHPRYVRSVRGRGYQLCEPPLSTEALIVEEPLATRR
SPVAWIAGLGVLALAAAGGWWWHRSTGGPGGVDPAQTLLNRAAYYAGIGQKDNNERAINL
YQQVLAGDPASTAAHLGLSRAYSARVCLYNFPYDWTQRAQREAETVLKTAPGNSGAWVAL
AYAHDCAGELAAALRAYEKALALDPNDDAARASAAYLYQEQGRLADALHANLDMHGDPAR
VRFRAVQIARELELLGFTDAAERRYRESFQLYPDNVFSNIAWPRHLFLQGRFKEAQDALD
QALARNTPHVDLYVLGGELALLRGDRDAARHAFEQARQLRPQMSAPTTLATLYGTAAPTP
AWLDERIAQLQRQFLGGAGYPGDYLELALLQEARGLRADALRSVDTAVQAGYSDRAYLQT
SPLLRGLANEPAYAASIDALSRRGAAQRAQVLAADWRPADLRDVH