Protein Info for ABZR86_RS15055 in Dyella japonica UNC79MFTsu3.2

Annotation: S9 family peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 754 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00930: DPPIV_N" amino acids 115 to 451 (337 residues), 303.8 bits, see alignment E=5.9e-94 PF02129: Peptidase_S15" amino acids 496 to 636 (141 residues), 44.4 bits, see alignment E=8.2e-15 PF12697: Abhydrolase_6" amino acids 532 to 667 (136 residues), 31.8 bits, see alignment E=1.1e-10 PF00326: Peptidase_S9" amino acids 541 to 736 (196 residues), 188.5 bits, see alignment E=5e-59 PF01738: DLH" amino acids 542 to 720 (179 residues), 32.9 bits, see alignment E=2.2e-11 PF07859: Abhydrolase_3" amino acids 578 to 713 (136 residues), 26.6 bits, see alignment E=2.2e-09

Best Hits

Swiss-Prot: 57% identical to DAP4_PSEMX: Dipeptidyl aminopeptidase 4 (dap4) from Pseudoxanthomonas mexicana

KEGG orthology group: K01278, dipeptidyl-peptidase 4 [EC: 3.4.14.5] (inferred from 53% identity to fbl:Fbal_3120)

Predicted SEED Role

"Dipeptidyl peptidase IV"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.14.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2K0P7 at UniProt or InterPro

Protein Sequence (754 amino acids)

>ABZR86_RS15055 S9 family peptidase (Dyella japonica UNC79MFTsu3.2)
MRALLFAALTMVTLPTMAEKLTIERIFDGGSLAGPAPRGLQISPDGSRITFLRARPDDQF
QLDLWEYRPKDNSTRMLVDSRKLEPQGEQLSDAEKARRERARTAGLRGILSYQWSPDGKQ
LLFPIGGKLYLYDLAAVKPVPRALDTGGDAIDPKISPKGRYVSYVRDQNLWVIDLDSGDA
RQLTRDGGGNVHNGEAEFVAQEEMGRSSGYWWAPDDSAIAFERYDESKVPVVKRTEVYAD
RTDVIEQRYPAAGDPNVAVKLGLVAPTGGAPRWVDLGKDADIYLVRVNWLTDGKHLSYQR
MPRSQQKLELRLVDAKSLAQRTLLTETGTTWINLNDDLRFLKDGKSFLWGSERSGFHHLY
LYGLDGKLKHPVSQGDWQIDGVLAVDEHAGTVYVGSNRDFVPDHQVYALKLDGSTANAPV
RISKGDGSHLAEFAPNAAFYLDTYSSADTPPQVSVHKPDGTFLSWIEQNKLDEKHPFWPY
RASLIKPEFGTVKSADGQTLYYRLYKPAGFDPTRKYPVFDTYYGGPHAQLVASGWGDYFN
QYMANQGYVVFTLDNRGMARRGRKFEDPIYEQLGAVEVDDQLAGIDWLKTQPWVDGRRIG
VFGWSYGGYMTAMLLAKASKDIAGGVAVAPVTDWRLYDTFYTERYLGRPQDNEAGYTRSS
PFAWLDGLTSKLYLVHGMADDNVLFVNSTKLMAELQKRGTQFQFMAYPGAKHGLNLPGQR
SHVYHLIANFFDREIKGAAAPAAPKPAAAASVAP