Protein Info for ABZR86_RS14865 in Dyella japonica UNC79MFTsu3.2
Annotation: ParB/RepB/Spo0J family partition protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 57% identical to PARB_XYLFT: Probable chromosome-partitioning protein ParB (parB) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)
KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 57% identity to xfm:Xfasm12_1473)Predicted SEED Role
"Chromosome (plasmid) partitioning protein ParB" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1I2IQ88 at UniProt or InterPro
Protein Sequence (289 amino acids)
>ABZR86_RS14865 ParB/RepB/Spo0J family partition protein (Dyella japonica UNC79MFTsu3.2) MAAAKKRGLGRGLDALLGGGDDAPSVIEQEGELRMLPIQYIQPGKYQPRRHWNDEALDEL AASIKAQGLIQPVVVREIGKNSYELIAGERRWRAAQRAQLSELPALVKDVPEVAVPAMAL IENIQRQDLTPLEEADALKRLIDDFDLTHQQAAEAVGRSRAAVSNLLRLTELPNSIKRLL DEGKLEMGHARCLLTLPQHDAEGLALEAARHGWSVRELEDAARRAQTAPKGKAKSAAAAR DPNVDALERELAERFATRVEVAHGRGGRGKLVIHYHSNDELEGILGKIR