Protein Info for ABZR86_RS14295 in Dyella japonica UNC79MFTsu3.2

Annotation: NAD(P)/FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 555 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 10 to 219 (210 residues), 40.3 bits, see alignment E=5.2e-14 PF00743: FMO-like" amino acids 12 to 214 (203 residues), 52.4 bits, see alignment E=6.5e-18 PF13738: Pyr_redox_3" amino acids 12 to 211 (200 residues), 38.2 bits, see alignment E=2.1e-13 PF13450: NAD_binding_8" amino acids 13 to 63 (51 residues), 29.6 bits, see alignment 1.4e-10

Best Hits

Swiss-Prot: 52% identical to BVMO_PSEBH: Baeyer-Villiger monooxygenase (OB2597_18631) from Pseudooceanicola batsensis (strain ATCC BAA-863 / DSM 15984 / KCTC 12145 / HTCC2597)

KEGG orthology group: None (inferred from 58% identity to nda:Ndas_5034)

MetaCyc: 52% identical to cyclohexanone monooxygenase (Acinetobacter johnsonii)
Cyclohexanone monooxygenase. [EC: 1.14.13.22]

Predicted SEED Role

"Cyclohexanone monooxygenase (EC 1.14.13.22)" (EC 1.14.13.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2J7Y8 at UniProt or InterPro

Protein Sequence (555 amino acids)

>ABZR86_RS14295 NAD(P)/FAD-dependent oxidoreductase (Dyella japonica UNC79MFTsu3.2)
MDIRQKSAVDAIVIGAGIAGIYALHKLRNELKLEVRGFEKGAGVGGTWFWNRYPGARSDT
ESYVYRYSFDPETFEGWPWTQKYASQEQMLAYLNAVVDRHGLRPSIQFDTRVTAATFDEQ
RGVWSVQTSDGAVVEARYLIASVGVLSKLNAPAIAGIDRFEGRQVHTGAWPHDLSLEGKK
VGVIGTGSTGVQFIPAAAAVASRLTVFQRSAQYCVPAGSDQVPAEFIQDYRANFDGYWDR
LRQTRIACGFAEAAIPAMSVSAEERHRVFEEHWQAGNGFRFMFGTFCDIAIDPAANEAAC
DFIRGKIAGIVKDPATAARLSPTQAYAKRPVCADGYYETFNRPNVALVDLKANPIVEATA
RGVRTADGREHELDVLVYATGFECVEGSYREMAIRGRDGALLVDHWGSRPCSYLGISVHG
FPNLFMVLGPNSVFSNLAPAIETQVDWIAHLIDRSEQLGQVVIDTDSAAEQDWTGQCEQM
AAYTLFPQVKSWIFGANIDGRPNRVLFFFGGLAAYRERLAEIAANGYAGYAFAPAEATIL
AASNDAVLSPSPWLA