Protein Info for ABZR86_RS12030 in Dyella japonica UNC79MFTsu3.2

Annotation: (Fe-S)-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13237: Fer4_10
  • amino acids 17 to 82 (66 residues), 29 bits, E=4.7e-10
• PF13183: Fer4_8
  • amino acids 17 to 85 (69 residues), 51.3 bits, E=7.9e-17
• PF12800: Fer4_4
  • amino acids 18 to 33 (16 residues), 13.6 bits, see alignment (E = 4.2e-05)
  • amino acids 69 to 83 (15 residues), 16.2 bits, see alignment (E = 6.1e-06)
• PF00037: Fer4
  • amino acids 18 to 35 (18 residues), 22.9 bits, see alignment (E = 3.1e-08)
• PF13534: Fer4_17
  • amino acids 19 to 85 (67 residues), 40.5 bits, E=1.8e-13
• PF12838: Fer4_7
  • amino acids 19 to 85 (67 residues), 41.2 bits, E=1.1e-13
• PF13484: Fer4_16
  • amino acids 19 to 84 (66 residues), 42.3 bits, E=6e-14
• PF02754: CCG
  • amino acids 178 to 260 (83 residues), 44 bits, E=1.1e-14
  • amino acids 291 to 375 (85 residues), 33 bits, E=3.1e-11

Predicted SEED Role

"Glycolate dehydrogenase (EC 1.1.99.14), iron-sulfur subunit GlcF" in subsystem Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 1.1.99.14)

MetaCyc Pathways

• glycolate and glyoxylate degradation II (2/2 steps found)
• glycolate and glyoxylate degradation I (2/4 steps found)
• superpathway of glycol metabolism and degradation (4/7 steps found)
• glycolate and glyoxylate degradation III (1/3 steps found)
• photorespiration III (5/9 steps found)
• photorespiration II (5/10 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.99.14

Use Curated BLAST to search for 1.1.99.14

Sequence Analysis Tools

See A0A1I2GYL0 at UniProt or InterPro

Protein Sequence (400 amino acids)

>ABZR86_RS12030 (Fe-S)-binding protein (Dyella japonica UNC79MFTsu3.2)
MMNRPEEKPPIRIAALADQCVQCGLCLPVCPTYALDRNEAESPRGRIAIAAALARGQASP
TAELREHLDHCLGCMGCEKVCPANVRYGELLVETRALLGPALQRPEHEIGLVRDPRRWRR
LRRGLGWLGFAGWKSALAKSLPARSALRSALALWPRTPLPEPYLAQPASDKAADGDTVAL
FPGCIASVEDADAQRAARTLLRAAGYRVVELPAFCCGAMDLHGGDTARAEQAAAQVSAAW
QDAQADHLVTVTPGCVGTLRHVLPGVRVADPMALLAARAQRLSFRPLPTRVAVHLPCTQS
NVARSDDALLRLLRRVPGLDVAPLPKPPHCCGAAGTHVLEFPERAARLREDTLRQVAALA
PRRLLSSNIGCRLHLAAGMQNERDWPHQHPLVLLAQQLET