Protein Info for ABZR86_RS11415 in Dyella japonica UNC79MFTsu3.2

Annotation: P-type DNA transfer ATPase VirB11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 TIGR02788: P-type DNA transfer ATPase VirB11" amino acids 26 to 335 (310 residues), 432.6 bits, see alignment E=3.6e-134 PF00437: T2SSE" amino acids 29 to 321 (293 residues), 143.1 bits, see alignment E=4.7e-46

Best Hits

Swiss-Prot: 45% identical to VIRBB_BRUME: Type IV secretion system protein VirB11 (virB11) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K03196, type IV secretion system protein VirB11 (inferred from 85% identity to smt:Smal_2445)

MetaCyc: 45% identical to P-type DNA transfer ATPase VirB11 (Brucella abortus 2308)
TRANS-RXN-477 [EC: 7.4.2.8]

Predicted SEED Role

"ATPase provides energy for both assembly of type IV secretion complex and secretion of T-DNA complex (VirB11)" in subsystem Type 4 secretion and conjugative transfer or pVir Plasmid of Campylobacter

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2HJ44 at UniProt or InterPro

Protein Sequence (344 amino acids)

>ABZR86_RS11415 P-type DNA transfer ATPase VirB11 (Dyella japonica UNC79MFTsu3.2)
MDDGALAQVSNEFLEYQYEVLGIKEFMASPEVTEICINKPGELYLESRGGWQRMEIPSLT
FDRARQFCTAVVNESNTGQRITDADPVVSLTFPTGQRAQFVIPPAVEAGKVSITIRLPSK
QTKTLAQYHDDGFFSEIIEDAHGVSSQDQELLDLRTQRRYADFFRQAVLYKKNIVVSGAT
GSGKTTFMKSLVHHIPHHERLVSIEDARELFLDQPNVVHLLYSKGGQSTSNVTAKSCMEA
CLRMKPDRIILAELRGDESFYFIRNCASGHPGSITSCHAGSPEQTWDQLALMVKASAEGS
GLEFSTIKRLLQMTIDIVVHIKAHAGRRYITGIDFNPARQFAAA