Protein Info for ABZR86_RS09585 in Dyella japonica UNC79MFTsu3.2

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 76 to 102 (27 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details PF07730: HisKA_3" amino acids 185 to 251 (67 residues), 67.6 bits, see alignment E=1.1e-22 PF02518: HATPase_c" amino acids 285 to 371 (87 residues), 32.4 bits, see alignment E=1.1e-11

Best Hits

KEGG orthology group: K07778, two-component system, NarL family, sensor histidine kinase DesK [EC: 2.7.13.3] (inferred from 44% identity to xcv:XCV4087)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2I8T4 at UniProt or InterPro

Protein Sequence (386 amino acids)

>ABZR86_RS09585 sensor histidine kinase (Dyella japonica UNC79MFTsu3.2)
MRLPFAPAPDSLYSQLRSPAFVLRSALGQAIWVVMLPVVPFSVHGFAWSWFAPTLLSMAV
FLYLHAQVYFGSSRRLHWYVMGMVVMGLGLWRANPVALGYVVSACTALSASPSYRLWLRG
VAMIALATLLATVLWVQVPWWVMLVMFVGAVLGGSSNFLYINNLRKDADLRLTQIEVRRL
AMLAERERIGRDLHDLLGHTLSLVAIKSELARRLALEDPPRAQQEMTEVERVARHALAEV
RAAVTGMRRSDLASEIISARLMLEASGVSFDSELPEGSALPPAVEAPLALVLREAVTNIH
RHARASAASVRFVHDKARFQMHISDNGCGGLAAHGNGVSGMRERVRALGGSLEIDSPKRR
GTCLRIEVPLARLAHAAPASLPESAA