Protein Info for ABZR86_RS08850 in Dyella japonica UNC79MFTsu3.2

Annotation: alanine racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00492: alanine racemase
  • amino acids 4 to 355 (352 residues), 353.7 bits, E=5.2e-110
• PF01168: Ala_racemase_N
  • amino acids 9 to 221 (213 residues), 210.6 bits, E=2.5e-66
• PF00842: Ala_racemase_C
  • amino acids 236 to 355 (120 residues), 134.8 bits, E=1.4e-43

Best Hits

Swiss-Prot: 48% identical to ALR_SHESR: Alanine racemase (alr) from Shewanella sp. (strain MR-7)

KEGG orthology group: K01775, alanine racemase [EC: 5.1.1.1] (inferred from 49% identity to mmt:Metme_2756)

MetaCyc: 46% identical to alanine racemase 1 (Escherichia coli K-12 substr. MG1655)
Alanine racemase. [EC: 5.1.1.1, 5.1.1.10]

Predicted SEED Role

"Alanine racemase (EC 5.1.1.1)" in subsystem Alanine biosynthesis or Pyruvate Alanine Serine Interconversions (EC 5.1.1.1)

MetaCyc Pathways

• anaerobic energy metabolism (invertebrates, cytosol) (7/7 steps found)
• alanine racemization (1/1 steps found)
• serine racemization (1/1 steps found)
• vancomycin resistance II (2/3 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
• L-alanine degradation I (1/2 steps found)
• L-lysine degradation V (2/9 steps found)
• ansatrienin biosynthesis (1/9 steps found)
• cyclosporin A biosynthesis (2/15 steps found)
• superpathway of L-lysine degradation (7/43 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Cysteine metabolism
• D-Alanine metabolism
• D-Arginine and D-ornithine metabolism
• D-Glutamine and D-glutamate metabolism
• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.1 or 5.1.1.10

Sequence Analysis Tools

See A0A1I2DFV9 at UniProt or InterPro

Protein Sequence (362 amino acids)

>ABZR86_RS08850 alanine racemase (Dyella japonica UNC79MFTsu3.2)
MSRTTVATIHLGALRHNLARIKAMAAPAQVMAVVKADAYGHGLERVARALDGAADAFAVA
AQGDGLRLRAAGHRQRIVVLSGPDRASDIAEMQRLQLDAAIHHESQLAWLDGASSSRGPL
RVWLKVDTGMHRLGFPPERAAEIHARLASMPGIDPEVGLLTHFSESEEFEGEETRAQIRR
FNEAVKNLAGPRALSNSAGVLGWPDARGDWVRTGGLLYGLSVVPGKSGADFGFRPAMTLT
TRLIAVNRIRRGERVGYNGTWTCPEDMPVGVAAVGYGDGYPRSAASGTPVLVGDRRVPLV
GRVSMDLITLDLREAPQAKVGDRVTLWGAELPVEHIAAQAGTISYDLTCGMTRRVLFVED
DG