Protein Info for ABZR86_RS08530 in Dyella japonica UNC79MFTsu3.2

Annotation: PAS-domain containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 883 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 299 to 320 (22 residues), see Phobius details PF02743: dCache_1" amino acids 45 to 234 (190 residues), 54.5 bits, see alignment E=3.5e-18 PF12860: PAS_7" amino acids 369 to 482 (114 residues), 145.5 bits, see alignment E=2.2e-46 PF08448: PAS_4" amino acids 369 to 477 (109 residues), 24 bits, see alignment E=1.2e-08 PF00512: HisKA" amino acids 517 to 581 (65 residues), 38.8 bits, see alignment 2.4e-13 PF02518: HATPase_c" amino acids 626 to 734 (109 residues), 77.7 bits, see alignment E=2.8e-25 PF00072: Response_reg" amino acids 762 to 873 (112 residues), 57 bits, see alignment E=6.2e-19

Best Hits

KEGG orthology group: None (inferred from 55% identity to xal:XALc_0736)

Predicted SEED Role

"Sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DMK3 at UniProt or InterPro

Protein Sequence (883 amino acids)

>ABZR86_RS08530 PAS-domain containing protein (Dyella japonica UNC79MFTsu3.2)
MAIRFRHGKIFAIAALLAAGMALSALLAYRIALRQSLGRMAGDSAQQLQLQSLALQRLID
RYRVLPGTLALDPELRAALLAPPDATMQHYLNIKLEHANGVTHASTLTLLDRDGLALAAN
NWREPSSNVGHRYDFRPYFQGAVAHGVGTFYAVGISTHVPGYFIAEAVKGPRGEVIGVIS
VKVPLGELEREWLHGDGTLLLSDRNGVVFLTNQPEWEFRELSPLKPSEAAQMEATRQYEG
QQLRRADYRVLDELGDGSRLVRIVEPAGRGARLWSSLELPLEGWSLHLLRNAAGSLATAR
LAAAVAAGAWAPLILLGLFLQQRRRLIQHRLQSRAELERLVAHYTGELRSAQDSVVQAAE
AAASRNASLEHLPQGVSVVDRELRLVAWNTRYQEIFKFPPGLLQTGMPIEDVLRYNARLG
RLGPGSVEEAIQRRLDHMRSGSAHMFERERPDGSVLEIRGNPLPGGGFVTSFADITAYKA
AARDLRNLATTLEQRIEERTHDLEAAKAEAEHANRGKTRFVAAAVHDLLQPLNAARMYVG
VLRGRLPGGDDRALADRVESALQAQDDLLASLLDMARLEAGALSARAVDLPLEPLLTGLA
RQFGILAQSRGLALHYVPCQATVHSDPLLLRRVLQNFLSNAIHYTPRGRVLLGCRRVDAG
VRIEVWDTGVGIPEAKRQAIFEEFRRLDTGIERDGRSAGLGLSIVDRIARLLDHRIGLRS
WPERGSAFSVTVPYGDPAGVPAAPVASSAVTDEDSPLRGCRVWCIDDAPRVREATGALLR
HWGCEATLVDSAEQAMALARAGEAPDLLLLDYQLGEDVTGLDLLPRLAGRWGVQPPTIVL
SAQKDAQTRMRVQEAGLRFLPKPAAPAALRAVISQALLASGAS