Protein Info for ABZR86_RS07765 in Dyella japonica UNC79MFTsu3.2

Annotation: AlkA N-terminal domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 PF02805: Ada_Zn_binding" amino acids 16 to 79 (64 residues), 98.1 bits, see alignment E=4.6e-32 PF12833: HTH_18" amino acids 114 to 192 (79 residues), 72.4 bits, see alignment E=6.4e-24 PF06029: AlkA_N" amino acids 204 to 321 (118 residues), 112.4 bits, see alignment E=3e-36 PF00730: HhH-GPD" amino acids 327 to 455 (129 residues), 32.5 bits, see alignment E=1.8e-11

Best Hits

KEGG orthology group: K13529, AraC family transcriptional regulator, regulatory protein of adaptative response / DNA-3-methyladenine glycosylase II [EC: 3.2.2.21] (inferred from 61% identity to psu:Psesu_1932)

Predicted SEED Role

"ADA regulatory protein" in subsystem DNA repair, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.21

Use Curated BLAST to search for 3.2.2.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2E181 at UniProt or InterPro

Protein Sequence (502 amino acids)

>ABZR86_RS07765 AlkA N-terminal domain-containing protein (Dyella japonica UNC79MFTsu3.2)
MATVPAPHAPLPDRLCEQARLSRDARFDGLFFTAVTSTRIYCRPVCPAPSPKPENVRYYA
SAAAAEAAGFRPCLRCRPELAPGNDSWQRGDHVIARALKLMEQGALEDDSLEDMAQRLGV
GARQLRRVFVERLGAPPISVHTTRRLLFAKQLLTETELPVTDVALASGFRSLRRFNAAFQ
QANRMPPRELRRHPAKAAEGGLVLRLGYRPPYDFEAILSFLRTRSLPGVEQVDEHSYARV
FGPADAPGWLRLSAWPGGEHALKLELQCPQPARMLGVVSKLRRMFDLDADPQAIGAVMRA
GGVLKPLHQRRPGLRLPGGWDGFEIAVRAILGQQVSVAAARTLATRIVHRWGTPVSGIAA
PGLERLFPGPEILVDVDLREVGLTSARANTVDGVARALLDGRIDFRSEQPLDAFVASWVE
LAGIGEWTAHYMAMRALSHPDAFPAADLILRRVAAGDGAELSTRALTALAEDWRPWRAYA
VMHLWRAATDAAEHAKAKGKSA