Protein Info for ABZR86_RS07255 in Dyella japonica UNC79MFTsu3.2

Annotation: signal peptidase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR02227: signal peptidase I" amino acids 14 to 206 (193 residues), 150.4 bits, see alignment E=2e-48 PF10502: Peptidase_S26" amino acids 15 to 201 (187 residues), 146.7 bits, see alignment E=3.2e-47

Best Hits

KEGG orthology group: K03100, signal peptidase I [EC: 3.4.21.89] (inferred from 59% identity to bgd:bgla_2g26450)

Predicted SEED Role

"Signal peptidase I (EC 3.4.21.89)" in subsystem Signal peptidase (EC 3.4.21.89)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.89

Use Curated BLAST to search for 3.4.21.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2FYS7 at UniProt or InterPro

Protein Sequence (224 amino acids)

>ABZR86_RS07255 signal peptidase I (Dyella japonica UNC79MFTsu3.2)
MRRFKEFLLRNRGFFAFMFCMLVFRSAVADWNVVPTGSMQPTIRIGDRIVVDKAAYDIRL
PFTHVSLLHRADPARGDIVVLESEKAGERLVKRVVGVPGDVVALRGNRLYVNGRFADYRA
MHVDGIADDAWDPAVYVSEKVDGRSHAVRWSEYNASADRNFGPVTVPPGRYLMMGDNRDN
SRDSRYYGFFPRDEITGRAIRVAISLDPDRHYLPRSGRYWTRLE