Protein Info for ABZR86_RS05540 in Dyella japonica UNC79MFTsu3.2

Annotation: nucleoside-diphosphate sugar epimerase/dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 631 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 113 to 130 (18 residues), see Phobius details PF13727: CoA_binding_3" amino acids 65 to 242 (178 residues), 58.4 bits, see alignment E=4.1e-19 PF00106: adh_short" amino acids 285 to 356 (72 residues), 27.2 bits, see alignment E=1e-09 PF04321: RmlD_sub_bind" amino acids 286 to 412 (127 residues), 49.1 bits, see alignment E=1.7e-16 PF02719: Polysacc_synt_2" amino acids 287 to 569 (283 residues), 362.4 bits, see alignment E=6.5e-112 PF08659: KR" amino acids 287 to 409 (123 residues), 23.5 bits, see alignment E=1.9e-08 PF01370: Epimerase" amino acids 287 to 504 (218 residues), 70.7 bits, see alignment E=5.2e-23 PF16363: GDP_Man_Dehyd" amino acids 288 to 411 (124 residues), 37.9 bits, see alignment E=6e-13

Best Hits

KEGG orthology group: None (inferred from 58% identity to nhl:Nhal_2428)

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1XMU5 at UniProt or InterPro

Protein Sequence (631 amino acids)

>ABZR86_RS05540 nucleoside-diphosphate sugar epimerase/dehydratase (Dyella japonica UNC79MFTsu3.2)
MSVRKLIAVIHPRAAVVLHDLLMAALAWWVAKSLRYALVGDVSVHFHLLEFPLVLAVQGL
VLNWTGLYRGLWRFASLPDLWNILRAAVIGSLAIGLILFLYNRLEDVPRSVLLVYPVVLS
MLLGGPRLAYRFWKDSRIDMFQSQPVQRVLIVGADRAGEALARDLHRDSRYAVVGFVDDH
DSLRGASINGRPVLGRIELLPELAREVAAQMLLIAMPGASTEEMRRIVELCDQTGLPYRT
VPKLEDVVAGRAQFNEIKEVAIEDLLGRDAVELDWTAIRETLTGKRVLVTGGGGSIGSEL
CRQVARLGAQSLCVVDNGEFNLYQIAQELRQEFPELLFEPILADCGDPAAMTRLFVEFKP
QVVFHAAAYKHVPLLQGQLRSAFRNNVLASRNMADLADRHHAECFVLISTDKAVNPTSVM
GACKRIAEIWCQNFDARSTTRYITVRFGNVLDSAGSVVPLFRKQIRAGGPVTITHPEISR
YFMTIPEACQLILQAASLGKGGEIFALDMGEPVKIRDLAEQMIRLAGKKPGTEIPIVFTG
LRSGEKLFEELFHPLENYTATAHAKIFLAQYRQVGWDLLQAQLVKASEATVAYDEETLRR
CVSSLLPSFRWSDVAQPDNVVSIRRNESGEK