Protein Info for ABZR86_RS05410 in Dyella japonica UNC79MFTsu3.2

Annotation: IMP dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 PF00478: IMPDH" amino acids 7 to 470 (464 residues), 546.3 bits, see alignment E=8.4e-168 TIGR01302: inosine-5'-monophosphate dehydrogenase" amino acids 7 to 451 (445 residues), 634.3 bits, see alignment E=5.6e-195 PF00571: CBS" amino acids 93 to 138 (46 residues), 47.5 bits, see alignment 5.4e-16 amino acids 147 to 202 (56 residues), 37 bits, see alignment 1e-12 PF03060: NMO" amino acids 202 to 369 (168 residues), 37.1 bits, see alignment E=7.7e-13 PF01070: FMN_dh" amino acids 257 to 361 (105 residues), 37.9 bits, see alignment E=3.4e-13 PF01645: Glu_synthase" amino acids 276 to 359 (84 residues), 21.9 bits, see alignment E=2.7e-08

Best Hits

Swiss-Prot: 68% identical to IMDH_ACICA: Inosine-5'-monophosphate dehydrogenase (guaB) from Acinetobacter calcoaceticus

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 78% identity to psu:Psesu_1413)

MetaCyc: 63% identical to inosine 5'-monophosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1XQD8 at UniProt or InterPro

Protein Sequence (485 amino acids)

>ABZR86_RS05410 IMP dehydrogenase (Dyella japonica UNC79MFTsu3.2)
MRILAEALTYDDVYLVPAHSAVLPRDVDTSTRLTRNLRLNIPIVSAAMDTVTEARLAITM
AQQGGIGIIHKNMTAEQQAAEVRLVKKFEAGVIRSPITVGPHTSIREVLQLTRAHNISGV
PVVEGEKLVGIVTSRDLRFERKHDDPVRNIMTRQEKLVTVREGASQDDVLQLLHQNRIEK
VLVVNDDFQLRGLITVKDIQKARDNPNAAKDRHERLLVGAAVGVGGDTEQRVAALVDAGV
DVLVVDTAHGHSQGVIERAAWVKKHYPQVQVIAGNIVTGEAARALLDAGVDAVKVGVGPG
SICTTRVVAGVGVPQITAIDLVATALKDEIPLIADGGIRYSGDIPKALAAGASSVMLGSM
FAGTEESPGEVELFQGRSYKSYRGMGSLGAMALGSKDRYFQDEADADKLVPEGIEGRVPY
RGPLRNIIHQLIGGLRASMGYLGAATIEDVRQKAQFVKVTSAGVTEAHPHDIQITKEAPN
YRLNS