Protein Info for ABZR86_RS04530 in Dyella japonica UNC79MFTsu3.2

Annotation: L-seryl-tRNA(Sec) selenium transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF12390: Se-cys_synth_N" amino acids 9 to 48 (40 residues), 36.7 bits, see alignment 3.8e-13 TIGR00474: L-seryl-tRNA(Sec) selenium transferase" amino acids 9 to 461 (453 residues), 577.1 bits, see alignment E=1.3e-177 PF03841: SelA" amino acids 82 to 449 (368 residues), 549.2 bits, see alignment E=4.6e-169

Best Hits

Swiss-Prot: 71% identical to SELA_METSB: L-seryl-tRNA(Sec) selenium transferase (selA) from Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)

KEGG orthology group: K01042, L-seryl-tRNA(Ser) seleniumtransferase [EC: 2.9.1.1] (inferred from 71% identity to msl:Msil_3334)

MetaCyc: 59% identical to selenocysteine synthase (Escherichia coli K-12 substr. MG1655)
L-seryl-tRNA(Sec) selenium transferase. [EC: 2.9.1.1]

Predicted SEED Role

"L-seryl-tRNA(Sec) selenium transferase (EC 2.9.1.1)" in subsystem Selenocysteine metabolism (EC 2.9.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.9.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1XAU6 at UniProt or InterPro

Protein Sequence (473 amino acids)

>ABZR86_RS04530 L-seryl-tRNA(Sec) selenium transferase (Dyella japonica UNC79MFTsu3.2)
MTGPEASSLRKLPAVATVLATGVAAALVERHGRVAATDAIRAAIDEARDAMRGTAASAPD
AAELAQRAAVRLDARLPGLRPLFNLTGTVLHTNLGRALLAEAAIEAAAAAMRHAVALEYD
LDGGERGERDDHLRGLLCELTGAEDATVVNNNAAAVLLCLNSLALGRDAVVSRGELIEIG
GAFRLPQIMERAGVRMVEVGTTNRTHPADYREAIGERTGLVLKVHTSNYRIQGFTAEVGA
RELAAIANAAGVPLLNDLGSGMLVDLSRYGLAREPTVREAVAEGARLVTFSGDKLLGGPQ
AGFIVGERALIERINRNPLKRALRVDKLRLAAIEATLNLYRDPDRLAERLPTLRFLARPQ
VDIEAQAQRLRPAVAQKLADTFVVTVGACASQVGSGALPLDTLASAALLIRPHGSQLMLD
RLATAMRALPQPIIGRIADGALQLDLRCLADADEDAFLASLTRLDLDATRSAP