Protein Info for ABZR86_RS00255 in Dyella japonica UNC79MFTsu3.2

Annotation: LLM class flavin-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF00296: Bac_luciferase" amino acids 4 to 294 (291 residues), 140 bits, see alignment E=5.7e-45 TIGR03558: luciferase family oxidoreductase, group 1" amino acids 4 to 323 (320 residues), 451.3 bits, see alignment E=9.8e-140

Best Hits

Swiss-Prot: 57% identical to YHBW_ECOL6: Luciferase-like monooxygenase (yhbW) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00494, alkanal monooxygenase (FMN-linked) [EC: 1.14.14.3] (inferred from 76% identity to xcb:XC_2545)

Predicted SEED Role

"Luciferase-like"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.14.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2C9R3 at UniProt or InterPro

Protein Sequence (332 amino acids)

>ABZR86_RS00255 LLM class flavin-dependent oxidoreductase (Dyella japonica UNC79MFTsu3.2)
MIPFSVLDLAPVTQGSTPAQAFTNSLDLARLAERLGYRRYWLAEHHNMPGIASAATSVLI
GHIAGGTSTIRVGAGGIMLPNHAPLQVAEQFGTLASLYPGRIDLGLGRAPGTDQPTARAL
RRYYDSADAFPEDVQELLMYFQPAQPGQAVRAVPGAGIDVPVWVLGSSLFGARLAAALGL
PYAFASHFAPDAMDEALALYRRDFRPSEHLAQPHAMLGINVIAAQSDAEARRLFTTQQQS
FINLRRGMPGLIPPPIDDIESYWTPTEKFGVERALACSVVGDADSVREGLLAFIERHKPD
ELMITANVFEHALRRRSYEMVAAIREELAAAA