Protein Info for ABIE53_006548 in Paraburkholderia graminis OAS925

Annotation: triphosphoribosyl-dephospho-CoA synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 164 to 183 (20 residues), see Phobius details TIGR03132: triphosphoribosyl-dephospho-CoA synthase MdcB" amino acids 71 to 337 (267 residues), 311.5 bits, see alignment E=2.8e-97 PF01874: CitG" amino acids 73 to 335 (263 residues), 232.7 bits, see alignment E=3.2e-73

Best Hits

Swiss-Prot: 57% identical to MDCB_PSEA8: Probable 2-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A synthase (mdcB) from Pseudomonas aeruginosa (strain LESB58)

KEGG orthology group: K13930, triphosphoribosyl-dephospho-CoA synthase [EC: 2.7.8.25] (inferred from 82% identity to bug:BC1001_5560)

Predicted SEED Role

"Triphosphoribosyl-dephospho-CoA synthetase (EC 2.7.8.25)" in subsystem Malonate decarboxylase (EC 2.7.8.25)

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.25

Use Curated BLAST to search for 2.7.8.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>ABIE53_006548 triphosphoribosyl-dephospho-CoA synthase (Paraburkholderia graminis OAS925)
MRAAALLEREDVPCVSAIEMPEPLARACAWTERGDAPYGRATQALHPVTTAAAAFDERVA
KRAQDSCPDSQLAHYAVTALIDEAELTPKPALVDRRGSGAHRDLDLAIMRRSAHALEPTF
AALARTARRRGEPSALLRAELAQIGRAGEQDMLRATGGSNAHRGAIWIVGLLVAGASFAD
AALRLDASAISRRAAQIACFPDRFAAATDSHGERARQRYQVGGARREAQEGFPHVIAVGL
PALIAARERGIAEDAARVDALLSIMASLDDTCLLHRAGLAGLHAGQHGAQRVLQAGGSST
RAGRDALAALERDLLSLNASPGGAADLLAATLFLDMLAHHDVSGS