Protein Info for ABIE53_006520 in Paraburkholderia graminis OAS925

Annotation: signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 83 to 106 (24 residues), see Phobius details amino acids 113 to 130 (18 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details PF00512: HisKA" amino acids 217 to 283 (67 residues), 51.5 bits, see alignment E=1.3e-17 PF02518: HATPase_c" amino acids 328 to 435 (108 residues), 94.1 bits, see alignment E=1.1e-30 PF00072: Response_reg" amino acids 463 to 578 (116 residues), 41.8 bits, see alignment E=1.7e-14

Best Hits

KEGG orthology group: None (inferred from 94% identity to bug:BC1001_5584)

Predicted SEED Role

"Sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (606 amino acids)

>ABIE53_006520 signal transduction histidine kinase (Paraburkholderia graminis OAS925)
MRADPIQRAIDEDLVRVLYAQDPIAFFSHWFSIAVLVAIYWPAIPSPPLFIACFGFYAAA
NCAGLALWICNRRYPHLLSPRGWINVHAVRGVLLYSAPGIAIWFAFQSPQSDLPLLHTVM
LVTLAAGVFMSNGFDLLNFATAIPFLLFPSIVLHFGMHTFDRTILAIVLAFFFCAINVYA
LSYRKLFQQVVQARVDQQYLAESLAAQKHVAEEASLAKTRFFAAASHDLRQPLHAIGLLA
ASLNDSAATPAQHAKTAEHIVHNVEALNQLFNQVLDLARLESGVTQVIRLHFRLSELFER
VGSQYRPQAAAKGLALRIAPTSMVVHDDPVLLERVLSNLLSNAVRYTEEGAIWLGFRRAG
RTNGGYIEVRDSGIGIPEQEHERIFEEFYQVANPQRDARQGHGLGLPTVKRLVGMLGGEL
QLRSAPGRGSVFRFPVQAGDASGIVASLNEAVTGGPTAQGRRVLCIDDEPSILEGLSSLL
GRWGCIVQGVRDETAALAALEEGFVPDAVLCDYQLANHRTGAQALTAVRSELARSGHEGV
VMLLITGDMASAELAALAAQGIPVLHKPVAAARLRRTLDMLWQQAEIDKGPTPPPATAFS
PLQASR