Protein Info for ABIE53_006249 in Paraburkholderia graminis OAS925

Annotation: urea carboxylase-associated protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03424: urea carboxylase-associated protein 1
  • amino acids 15 to 212 (198 residues), 333.7 bits, E=1.7e-104
• PF09347: DUF1989
  • amino acids 19 to 186 (168 residues), 229.9 bits, E=7.1e-73

Best Hits

KEGG orthology group: K09967, hypothetical protein (inferred from 93% identity to bge:BC1002_2565)

Predicted SEED Role

"Urea carboxylase-related aminomethyltransferase (EC 2.1.2.10)" in subsystem Urea decomposition (EC 2.1.2.10)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Nitrogen metabolism
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.10

Use Curated BLAST to search for 2.1.2.10

Protein Sequence (213 amino acids)

>ABIE53_006249 urea carboxylase-associated protein 1 (Paraburkholderia graminis OAS925)
MTTTLTVSDKRPEHAVFRETLAAGEPWLHELKAGQTLRILDLEGNQAVDTLFYSLADPRE
RFDPQRTLRRQKSLYLTTGTVLYSNLGNPLLTIVADTCGRHDTLGGACAQESNTVRYALE
KRYMHSCRDNYLRACAHDGRLSKQDIGANINLFMNVPVTSEGGLTFEDGISAPGKYVELR
AEMDVIVLISNCPQLNNPCNAYNPTPAELLIWN